PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G170900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 392aa    MW: 44320.2 Da    PI: 7.2723
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G170900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox696.1e-2283142357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Manes.14G170900.1.p  83 SRWNPTPEQLRTLEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 142
                          7*****************99**************************************97 PP

2Wus_type_Homeobox115.23.1e-3782144365
    Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
  Manes.14G170900.1.p  82 SSRWNPTPEQLRTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 144
                          79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.1E-580147IPR001356Homeobox domain
PfamPF000461.2E-1983142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.4E-983142IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1283149IPR009057Homeodomain-like
CDDcd000861.85E-684144No hitNo description
PROSITE profilePS5007111.20888143IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MWMMGYSDGG EFNVPDSFNG RKLRPLIPRN PPLPPSPNNT SNSSPPTLSL LHGNEFFSLN  60
HHLASMADQS KRDFHTQPVV VSSRWNPTPE QLRTLEELYR RGTRTPSAEQ IQHITAQLRR  120
YGKIEGKNVF YWFQNHKARE RQKRRRQMES TAPDHHHEQQ QNREIEIHGK KESGTNRTVY  180
EGEQTKNWAP STNCSALPEE AMSMQIRAAK GLVTECKGEE WNQFDEVELQ RRRSFMERNA  240
TWQMMQLSST YLINTSCSST TTTTSRILAE AEAEATASTP TVLAAGGSIR RSMDPNKQLI  300
KTHNDLNIFI APYRENSIGH GLINHFISNE EDHNGCGDSH QTLQLFPLCS SGGGESINDK  360
ETENSSASVA AAMNANFTTT HQFFEFLPLK N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088544.11e-175PREDICTED: WUSCHEL-related homeobox 1
TrEMBLA0A067JV941e-175A0A067JV94_JATCU; Uncharacterized protein
STRINGPOPTR_0015s04520.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-55WUSCHEL related homeobox 1